PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0183100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 393aa    MW: 45311.4 Da    PI: 4.8274
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0183100.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.5e-174390148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT +Ed +l +++k++G ++Wk++ +  g+ R++k+c++rw ++l
  ORGLA05G0183100.1 43 KGPWTSWEDSILEKYIKKHGERNWKLVQKNTGLLRCGKSCRLRWMNHL 90
                       79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.9223894IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-194193IPR009057Homeodomain-like
SMARTSM007174.8E-144292IPR001005SANT/Myb domain
PfamPF002497.7E-154390IPR001005SANT/Myb domain
SuperFamilySSF466896.39E-2244120IPR009057Homeodomain-like
CDDcd001671.89E-114590No hitNo description
PROSITE profilePS500906.72591232IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-1294123IPR009057Homeodomain-like
SMARTSM007175995132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MHESDSDPDS DRTHWYMSNS DDESFVDKDK DCRRSTVAPL LKKGPWTSWE DSILEKYIKK  60
HGERNWKLVQ KNTGLLRCGK SCRLRWMNHL RPNLKKGAFS KEEENKIINL HCKMGNKWSR  120
MAADXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX DYDSIEDQRN QIEVAAKYEI PLPVLKTTNN  240
DIFPSASIFA NHGISNGNLS ALSTTNALQM ELPLIQFDPN NQFVYSRAYA THLTNFALLN  300
DQSEELLNDT DVLNYVVMKE ELSGGSLSPT INMPCEAHNS MAASNELVVP RYEGDAPPLQ  360
DDFTSYFYLN DTNLSIFEDT NELFLENKLD TKG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1639122385B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD886210.0D88621.1 Oryza sativa mRNA for OSMYB5, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639103.11e-123PREDICTED: transcription factor GAMYB
TrEMBLA0A0D3G9911e-126A0A0D3G991_9ORYZ; Uncharacterized protein
STRINGORGLA05G0183100.11e-125(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP154081018
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.13e-40myb domain protein 33